Zu "GeneID 100339322" wurden 5 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
IL-17A (rabbit) Do-It-Yourself ELISA
Artikelnummer: DIY0963U-003
The Rabbit IL-17A Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IL-17A ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods...
| Schlagworte: | IL17A |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rabbit |
ab 1.056,00 €
Anti-IL-17A (rabbit)
Artikelnummer: KP0961U-100
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Schlagworte: | IL17A |
| Anwendung: | WB, ELISA |
| Wirt: | Chicken |
| Spezies-Reaktivität: | rabbit |
521,00 €
Anti-IL-17A (rabbit), Biotin conjugated
Artikelnummer: KPB0962U-050
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Schlagworte: | IL17A |
| Anwendung: | WB, ELISA |
| Wirt: | Chicken |
| Spezies-Reaktivität: | rabbit |
535,00 €
Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A...
Artikelnummer: 373794.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and...
| Schlagworte: | Interleukin 17A |
| MW: | 17,3 |
ab 675,00 €
IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag...
Artikelnummer: 373779.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA,...
| Schlagworte: | Interleukin 17A |
| MW: | 42,3 |
ab 636,00 €
